PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009626108.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 385aa    MW: 43361.1 Da    PI: 7.4449
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009626108.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM26.81.5e-084366225
             NAM  2 ppGfrFhPtdeelvveyLkkkveg 25
                    +pGfrFhPt+eelv +yL++kve+
  XP_009626108.1 43 MPGFRFHPTEEELVEFYLRRKVEA 66
                    79*******************986 PP

2NAM98.87.8e-317014553128
             NAM  53 aeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                      +ekewyf+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++++ +glkktLvfy+g+apkg +t+W+m+eyrl
  XP_009626108.1  70 IGEKEWYFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENSQSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 145
                     4789**********************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100533.83810166IPR003441NAC domain
SuperFamilySSF1019411.57E-4442165IPR003441NAC domain
PfamPF023656.5E-2544145IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MAIVPFTSII MSQSQQHEQQ DDTINNINNT IKDDDDHEHD MVMPGFRFHP TEEELVEFYL  60
RRKVEALAAI GEKEWYFYVP RDRKYRNGDR PNRVTTSGYW KATGADRMIR SENSQSIGLK  120
KTLVFYSGKA PKGIRTSWIM NEYRLPQHET ERLQKAEISL CRVHKRSGVE DHPSLPRSLP  180
TTRASSSSSS RGTTNSIKKQ HHQQVVQNSL ISPYVVGQSS QQQIDEKLST ETSASSTSTD  240
HHHHHHVATS LGLNSLSNSY NSIALDPMAG GAVTSTSSLS PFASLVSPSS TGAVVEDLHK  300
LINLDQQVAF HNQQHFHNNP INHIPAVASQ QFLQPQVLPH HAQPQSLLFQ GSLQSSSSFS  360
DRLWEWSSIQ TDANCKDYQP NNPFK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-41311666165NO APICAL MERISTEM PROTEIN
1ut4_B4e-41311666165NO APICAL MERISTEM PROTEIN
1ut7_A4e-41311666165NO APICAL MERISTEM PROTEIN
1ut7_B4e-41311666165NO APICAL MERISTEM PROTEIN
4dul_A4e-41311666165NAC domain-containing protein 19
4dul_B4e-41311666165NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754405e-33HG975440.1 Solanum pennellii chromosome ch01, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009626108.10.0PREDICTED: NAC transcription factor 25-like isoform X2
TrEMBLK4B1K21e-150K4B1K2_SOLLC; Uncharacterized protein
STRINGSolyc01g102740.2.11e-149(Solanum lycopersicum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.12e-85NAC domain containing protein 35